Cyhr1
WebJul 1, 2004 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1 gene ... WebItem Human Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit; Company MyBioSource.com; Price Pricing Info Supplier Page View Company Product Page; Catalog Number MBS7219175; Quantity 96 Strip Wells; Applications ELISA; Reactivity Human; Detection Target Cysteine and histidine rich protein 1 (CYHR1) Molecular Weight 22,766 …
Cyhr1
Did you know?
WebCYHR1 has 3,540 functional associations with biological entities spanning 8 categories (molecular profile, organism, chemical, functional term, phrase or reference, disease, … WebID: CYHR1_HUMAN DESCRIPTION: RecName: Full=Cysteine and histidine-rich protein 1; SUBUNIT: Interacts with LGALS3 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cytoplasm, perinuclear region (By similarity). Note=Shows a prominent perinuclear and cytoplasmic localization (By similarity). SIMILARITY: Belongs to the …
WebThis locus represents naturally occurring read-through transcription between the neighboring LOC84773 and cysteine and histidine rich 1 (CYHR1). It encodes a fusion protein that shares sequence identity with proteins encoded by both independent genes. [provided by RefSeq, Feb 2024] TMEM276-ZFTRAF1 TMEM276-ZFTRAF1 readthrough [ (human)] WebPre-made anti-CYHR1 monoclonal antibody (mab) is expressed by mammalian cell line as a benchmark antibody for cell culture, ELISA or other affinity binding assay or functional assay development, animal model development, PK/PD model development (Pharmacokinetics & Pharmacodynamic).
WebPharos is the web interface for data collected by the Illuminating the Druggable Genome initiative. Target, disease and ligand information are collected and displayed.
WebAcronym. Definition. PCHR. Palestinian Centre for Human Rights. PCHR. Personally Controlled Health Record (healthcare) PCHR. Philadelphia Commission on Human …
WebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM … earthquake soon in indiaWebCYHR1 cysteine and histidine rich 1 Location: Also known as: KIAA0496, MGC13010, CHRP Ensembl: ENSG00000187954 NCBI Entrez Gene: 50626 Perturbation Effects … ctm wholesaleWebDec 17, 2015 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1... ctm wifi蛋WebThis target displays homology in the following species: Cow: 93%; Human: 100%; Mouse: 100%; Rat: 100% Target Information CYHR1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include nucleoplasm; zinc ion binding. For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization. ctm wikipediaWebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% … ctm westgate contact numberWebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and … ctm white subway tilesWebCYHR1, KIAA0496. Organism names. Organism. Homo sapiens (Human) Taxonomic identifier. 9606 NCBI. Taxonomic lineage. Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo. Accessions. Primary accession. P0DTL6. … earthquake sound effect mp3